PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco000547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 461aa    MW: 50268.4 Da    PI: 9.1433
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco000547.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.51.4e-33191247360
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  DgynWrKYGqK+vkgsefprsYY+Ct+++Cpv+kkvers  d++v+ei+Y+geHnh+k
  Aco000547.1 191 DGYNWRKYGQKQVKGSEFPRSYYKCTHPNCPVRKKVERSL-DGQVTEIVYTGEHNHPK 247
                  9***************************************.***************85 PP

2WRKY971.2e-30386442359
                  -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  Dg++WrKYGqK+vkg+ +prsYYrCts++C+v+k ver+++d   +++tYegeHnh 
  Aco000547.1 386 DGFHWRKYGQKVVKGNSYPRSYYRCTSPKCNVRKYVERASDDSASFVTTYEGEHNHG 442
                  9*******************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.2E-30177248IPR003657WRKY domain
PROSITE profilePS5081124.96184248IPR003657WRKY domain
SuperFamilySSF1182902.35E-26188248IPR003657WRKY domain
SMARTSM007742.8E-38189247IPR003657WRKY domain
PfamPF031061.5E-26191246IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-31371444IPR003657WRKY domain
SuperFamilySSF1182909.81E-28378444IPR003657WRKY domain
PROSITE profilePS5081131.261379444IPR003657WRKY domain
SMARTSM007741.2E-35384443IPR003657WRKY domain
PfamPF031061.4E-24386441IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MQETQKIVVS KPVASRPFSS SRYFSEVLPG STSASPTTTL SDTAVAIRPK SLRPVTHQRE  60
SSAAISTSMD DASDSGVCNH LSDKASVVTL KSESKSAAIL YKPTAKAVSK NIASFLANLG  120
NFDATHQQVA TEKPAPVQIS EHINQNPHGN STAQVDISMY QISDPSNFVP RNIEQENVQQ  180
PSNGADRISY DGYNWRKYGQ KQVKGSEFPR SYYKCTHPNC PVRKKVERSL DGQVTEIVYT  240
GEHNHPKPQS SKKLLLGTQR QGSSSTECGK ESGNTQCGNN PVVEENSSHA LRLENKVDEG  300
FRGIKNYHGH VYLPNSSSSS DGFHGDFKIG ENSSELGGAT AGFSKDKPDY KRRKKDDQLS  360
GGSAAAAFVE PHSAAQNLVE SDVSGDGFHW RKYGQKVVKG NSYPRSYYRC TSPKCNVRKY  420
VERASDDSAS FVTTYEGEHN HGMPTKKNES SSLRTSLANP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-27191444677Probable WRKY transcription factor 4
2lex_A3e-27191444677Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6609041e-142KM660904.1 Ananas bracteatus clone 39356 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908962.11e-153PREDICTED: WRKY transcription factor 44-like isoform X1
RefseqXP_010908965.11e-153PREDICTED: WRKY transcription factor 44-like isoform X1
TrEMBLF6HQV71e-120F6HQV7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g03070.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1847669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-58WRKY family protein